General Information

  • ID:  hor005677
  • Uniprot ID:  P28673
  • Protein name:  C-flanking peptide of NPY
  • Gene name:  NPY
  • Organism:  Gallus gallus (Chicken)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  SSPETLISDLLLRESTENIPRSRFEDPSMW
  • Length:  30
  • Propeptide:  MQGTMRLWVSVLTFALSLLICLGTLAEAYPSKPDSPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLLRESTENIPRSRFEDPSMW
  • Signal peptide:  MQGTMRLWVSVLTFALSLLICLGTLAEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPY1R, NPY2R
  • Target Unid:  Q8QFM1, Q9DDN6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P28673-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005677_AF2.pdbhor005677_ESM.pdb

Physical Information

Mass: 402430 Formula: C152H241N41O52S
Absent amino acids: ACGHKQVY Common amino acids: S
pI: 4.1 Basic residues: 3
Polar residues: 9 Hydrophobic residues: 8
Hydrophobicity: -70 Boman Index: -8444
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: 10086.67 Extinction Coefficient cystines: 5500
Absorbance 280nm: 189.66

Literature

  • PubMed ID:  1549597
  • Title:  Strong evolutionary conservation of neuropeptide Y: sequences of chicken, goldfish, and Torpedo marmorata DNA clones.